Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scamp5 Peptide - C-terminal region

Scamp5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI426171, AW558254, Sc5

UniProt

Q9JKD3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scamp5 Rabbit Polyclonal Antibody (orb584346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064666

Preservative

Lyophilized powder

AA Sequence

VFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS708418 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (N/A), CF640R conjugate, 0.1mg/mL
BNC401776-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (N/A), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCTAIRE3 (CDK18) (C-term) Rabbit Polyclonal Antibody
AP53224PU-N 400 µL

PCTAIRE3 (CDK18) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3,4,4'-Trichlorocarbanilide-13C6 (Triclocarban-13C6)
TRC-T774202-1MG 1 mg

3,4,4'-Trichlorocarbanilide-13C6 (Triclocarban-13C6)

Sign In for Pricing
View Details
SMARCAL1 (NM_014140) Human Recombinant Protein
TP761703 50 µg

SMARCAL1 (NM_014140) Human Recombinant Protein

Sign In for Pricing
View Details
Human Interleukin 6 Receptor (IL6R) ELISA Kit
RD-IL6R-Hu-01 96 Tests

Human Interleukin 6 Receptor (IL6R) ELISA Kit

Sign In for Pricing
View Details