Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scamp5 Peptide - C-terminal region

Scamp5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI426171, AW558254, Sc5

UniProt

Q9JKD3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scamp5 Rabbit Polyclonal Antibody (orb584346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064666

Preservative

Lyophilized powder

AA Sequence

VFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (T-Cell Marker) (rSPN/839), CF740 conjugate, 0.1mg/mL
BNC742220-100 1x 100 µL

CD43 (T-Cell Marker) (rSPN/839), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Human IgM
AAF-003-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Human IgM

Sign In for Pricing
View Details
Mouse Fyn activation kit by CRISPRa
GA201492 1 Kit

Mouse Fyn activation kit by CRISPRa

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/1593), CF647 conjugate, 0.1mg/mL
BNC471593-100 1x 100 µL

Aurora B (Proliferation Marker) (AURKB/1593), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSMG4 Human Gene Knockout Kit (CRISPR)
KN425070 1 Kit

PSMG4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EMILIN3 Human Gene Knockout Kit (CRISPR)
KN416328 1 Kit

EMILIN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details