Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCAPER Peptide - N-terminal region

SCAPER Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ31533, FLJ31953, FLJ46212, KIAA1454, MSTP063, ZNF291, Zfp291

UniProt

Q9BY12

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_065894

Preservative

Lyophilized powder

AA Sequence

MMASFQRSNSHDKVRRIVAEEGRTARNLIAWSVPLESKDDDGKPKCQTGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Artery: peripheral
CP565814 150 µg

Tissue Protein Lysate, Artery: peripheral

Sign In for Pricing
View Details
2-Propylhexanoic Acid
TRC-P837100-1G 1 g

2-Propylhexanoic Acid

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (B2M/961), CF568 conjugate, 0.1mg/mL
BNC680961-500 1x 500 µL

Beta-2 Microglobulin (B2M) (B2M/961), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Diisopropylaminoethyl Chloride Hydrochloride-d14
TRC-D455424-2.5MG 2.5 mg

2-Diisopropylaminoethyl Chloride Hydrochloride-d14

Sign In for Pricing
View Details
CPS1 Recombinant Rabbit Monoclonal Antibody [JB40-33]
ET7107-69 100 µL

CPS1 Recombinant Rabbit Monoclonal Antibody [JB40-33]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Chicken IgY,  20nm
GAF-2354-20 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Chicken IgY, 20nm

Sign In for Pricing
View Details