Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCAPER Peptide - N-terminal region

SCAPER Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ31533, FLJ31953, FLJ46212, KIAA1454, MSTP063, ZNF291, Zfp291

UniProt

Q9BY12

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_065894

Preservative

Lyophilized powder

AA Sequence

MMASFQRSNSHDKVRRIVAEEGRTARNLIAWSVPLESKDDDGKPKCQTGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC16A Polyclonal Antibody
E-AB-16647-01 20 µL

CLEC16A Polyclonal Antibody

Sign In for Pricing
View Details
CLEC16A Polyclonal Antibody
E-AB-16647-02 60 µL

CLEC16A Polyclonal Antibody

Sign In for Pricing
View Details
CLEC16A Polyclonal Antibody
E-AB-16647-03 120 µL

CLEC16A Polyclonal Antibody

Sign In for Pricing
View Details
CLEC16A Polyclonal Antibody
E-AB-16647-04 200 µL

CLEC16A Polyclonal Antibody

Sign In for Pricing
View Details
JAK1 Rabbit Polyclonal Antibody
AP02649PU-S 50 µL

JAK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACSS3 Rabbit Polyclonal Antibody
AP17866PU-N 400 µL

ACSS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details