Scara3 Peptide - middle region
Scara3 Peptide - middle region
Product Specifications
Product Name Alternative
APC7, C130058N24Rik, CSR, CSR1, MSLR1, MSRL1
UniProt
Q8C850
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Scara3 Rabbit Polyclonal Antibody (orb330505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_766192
Preservative
Lyophilized powder
AA Sequence
KTIQTTLGASSQRISQNSESMHDLVLQVMGLQLQLDNISSFLDDHEENMH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15103904 1 Vial
Lentiviral human SLC6A7 shRNA (UAS) - Lentiviral human SLC6A7 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details MBS2102206-01 5x 96 Tests
Human Poly ADP Ribose Polymerase 4 (PARP4) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2102206-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)
Human Poly ADP Ribose Polymerase 4 (PARP4) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2102206-03 10x 96 Tests
Human Poly ADP Ribose Polymerase 4 (PARP4) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2102206-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)
Human Poly ADP Ribose Polymerase 4 (PARP4) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details