SCARB1 Peptide - N-terminal region
SCARB1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CD36L1, CLA-1, CLA1, MGC138242, SR-BI, SRB1, HDLQTL6
UniProt
F8W8N0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SCARB1 Rabbit Polyclonal Antibody (orb585549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001076428
Preservative
Lyophilized powder
AA Sequence
LEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CRYZL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B3]](https://cdn.genprice.uk/products/937/68dd1b6e061270361ea175cf/imageurl/ta504617am.webp)
TA504617AM 100 µL
CRYZL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B3]
Sign In for Pricing
View Details 
BNC043185-100 1x 100 µL
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (rADFP/1493), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC403019-500 1x 500 µL
CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![(5R,6S)-6-[(1R)-1-Hydroxyethyl]-7-oxo-3-[(3R)-3-pyrrolidinylthio]-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic Acid (>90%)](https://cdn.genprice.uk/products/572/5524471230742/imageurl/trc-h943013-5mg.webp)
TRC-H943013-5MG 5 mg
(5R,6S)-6-[(1R)-1-Hydroxyethyl]-7-oxo-3-[(3R)-3-pyrrolidinylthio]-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic Acid (>90%)
Sign In for Pricing
View Details 
