Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCARB1 Peptide - N-terminal region

SCARB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD36L1, CLA-1, CLA1, MGC138242, SR-BI, SRB1, HDLQTL6

UniProt

F8W8N0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCARB1 Rabbit Polyclonal Antibody (orb585549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001076428

Preservative

Lyophilized powder

AA Sequence

LEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COG8 activation kit by CRISPRa
GA113531 1 Kit

Human COG8 activation kit by CRISPRa

Sign In for Pricing
View Details
MRPS27 (NM_015084) Human Over-expression Lysate
LC402416 20 µg

MRPS27 (NM_015084) Human Over-expression Lysate

Sign In for Pricing
View Details
General Purpose Incubator BIGP-7701
BIGP-7701 1 Unit

General Purpose Incubator BIGP-7701

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705423 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human LRRC45 activation kit by CRISPRa
GA116387 1 Kit

Human LRRC45 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS701322 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details