Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scfd2 Peptide - middle region

Scfd2 Peptide - middle region

Product Specifications

Product Name Alternative

9330137G15, E430013M20Rik, STXBP1L1

UniProt

Q3TR67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scfd2 Rabbit Polyclonal Antibody (orb581918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848787

Preservative

Lyophilized powder

AA Sequence

LVSGLSSLCEHLGVREECFAVGPLSRVIATDLANYAPAKNRKKTATGRAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSA (Cathepsin A, Carboxypeptidase C, GSL, GLB2, NGBE, PPCA, PPGB) discontinued
210324-01 20 µL

CTSA (Cathepsin A, Carboxypeptidase C, GSL, GLB2, NGBE, PPCA, PPGB) discontinued

Sign In for Pricing
View Details
CTSA (Cathepsin A, Carboxypeptidase C, GSL, GLB2, NGBE, PPCA, PPGB) discontinued
210324-02 100 µL

CTSA (Cathepsin A, Carboxypeptidase C, GSL, GLB2, NGBE, PPCA, PPGB) discontinued

Sign In for Pricing
View Details
Porcine Apolipoprotein A1 ELISA Kit
IPCAPOA1KT 1 Each

Porcine Apolipoprotein A1 ELISA Kit

Sign In for Pricing
View Details
NSC 31206
T22386-01 25 mg

NSC 31206

Sign In for Pricing
View Details
NSC 31206
T22386-02 50 mg

NSC 31206

Sign In for Pricing
View Details
NSC 31206
T22386-03 100 mg

NSC 31206

Sign In for Pricing
View Details