Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scfd2 Peptide - middle region

Scfd2 Peptide - middle region

Product Specifications

Product Name Alternative

9330137G15, E430013M20Rik, STXBP1L1

UniProt

Q3TR67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scfd2 Rabbit Polyclonal Antibody (orb581918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848787

Preservative

Lyophilized powder

AA Sequence

LVSGLSSLCEHLGVREECFAVGPLSRVIATDLANYAPAKNRKKTATGRAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR4 (N-Term) (Mouse) Rabbit pAb
MBS8552517-01 0.1 mL

TLR4 (N-Term) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
TLR4 (N-Term) (Mouse) Rabbit pAb
MBS8552517-02 0.1 mL (AF405L)

TLR4 (N-Term) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
TLR4 (N-Term) (Mouse) Rabbit pAb
MBS8552517-03 0.1 mL (AF405S)

TLR4 (N-Term) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
TLR4 (N-Term) (Mouse) Rabbit pAb
MBS8552517-04 0.1 mL (AF610)

TLR4 (N-Term) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
TLR4 (N-Term) (Mouse) Rabbit pAb
MBS8552517-05 0.1 mL (AF635)

TLR4 (N-Term) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
TLR4 (N-Term) (Mouse) Rabbit pAb
MBS8552517-06 0.1 mL (APC)

TLR4 (N-Term) (Mouse) Rabbit pAb

Sign In for Pricing
View Details