Scg2 Peptide - middle region
Scg2 Peptide - middle region
Product Specifications
Product Name Alternative
Chcg
UniProt
P10362
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Scg2 Rabbit Polyclonal Antibody (orb579477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073160
Preservative
Lyophilized powder
AA Sequence
DIDRPDMFQSKTLSKGGYPKAPGRGMMEALPDGLSVEDILNVLGMENVAN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8422149-01 0.12 mL
Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
Sign In for Pricing
View Details MBS8422149-02 0.2 mL
Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
Sign In for Pricing
View Details MBS8422149-03 5x 0.2 mL
Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
Sign In for Pricing
View Details 