Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scg2 Peptide - middle region

Scg2 Peptide - middle region

Product Specifications

Product Name Alternative

Chcg

UniProt

P10362

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scg2 Rabbit Polyclonal Antibody (orb579477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073160

Preservative

Lyophilized powder

AA Sequence

DIDRPDMFQSKTLSKGGYPKAPGRGMMEALPDGLSVEDILNVLGMENVAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH-CMV-FUT11EF1A-EGFP-T2A-PURO
BZ0827-2 1 Vial

PCDH-CMV-FUT11EF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details
Lss (Lanosterol synthase) BioAssayTM ELISA Kit (Rat) discontinued
357129-01 48 Tests

Lss (Lanosterol synthase) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Lss (Lanosterol synthase) BioAssayTM ELISA Kit (Rat) discontinued
357129-02 96 Tests

Lss (Lanosterol synthase) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
CLGN (Calmegin) (PE)
137852-PE 100 µL

CLGN (Calmegin) (PE)

Sign In for Pricing
View Details
Reactive red 124
orb2565376-01 10 mg

Reactive red 124

Sign In for Pricing
View Details
Reactive red 124
orb2565376-02 50 mg

Reactive red 124

Sign In for Pricing
View Details