Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCG2 Peptide - N-terminal region

SCG2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CHGC, SN, SgII

UniProt

P13521

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCG2 Rabbit Polyclonal Antibody (orb579476) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003460

Preservative

Lyophilized powder

AA Sequence

KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycerol Kinase (GK) Acitivity Colorimetric Assay Kit
E-BC-K791-M-01 48 T (32 samples)

Glycerol Kinase (GK) Acitivity Colorimetric Assay Kit

Sign In for Pricing
View Details
Glycerol Kinase (GK) Acitivity Colorimetric Assay Kit
E-BC-K791-M-02 96 T (80 samples)

Glycerol Kinase (GK) Acitivity Colorimetric Assay Kit

Sign In for Pricing
View Details
Frozen Tissue Blocks, Gallbladder
CB511393 1 Block

Frozen Tissue Blocks, Gallbladder

Sign In for Pricing
View Details
NOS1 Antibody
KC-2829-01 50 μL

NOS1 Antibody

Sign In for Pricing
View Details
NOS1 Antibody
KC-2829-02 100 µL

NOS1 Antibody

Sign In for Pricing
View Details
NOS1 Antibody
KC-2829-03 1 mL

NOS1 Antibody

Sign In for Pricing
View Details