Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scg3 Peptide - C-terminal region

Scg3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1B1075, AI385542, Chgd, SgIII

UniProt

P47867

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scg3 Rabbit Polyclonal Antibody (orb584335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158262

Preservative

Lyophilized powder

AA Sequence

TGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse HIST1H1D siRNA
abx919405-01 15 nmol

Mouse HIST1H1D siRNA

Sign In for Pricing
View Details
Mouse HIST1H1D siRNA
abx919405-02 30 nmol

Mouse HIST1H1D siRNA

Sign In for Pricing
View Details
CLN3 (Ceroid-lipofuscinosis, Neuronal 3, BTS, Battenin, JNCL) (MaxLight 405)
MBS6411904-01 0.1 mL

CLN3 (Ceroid-lipofuscinosis, Neuronal 3, BTS, Battenin, JNCL) (MaxLight 405)

Sign In for Pricing
View Details
CLN3 (Ceroid-lipofuscinosis, Neuronal 3, BTS, Battenin, JNCL) (MaxLight 405)
MBS6411904-02 5x 0.1 mL

CLN3 (Ceroid-lipofuscinosis, Neuronal 3, BTS, Battenin, JNCL) (MaxLight 405)

Sign In for Pricing
View Details
2,3-Dimethylbutanoic Acid
419842-01 500 mg

2,3-Dimethylbutanoic Acid

Sign In for Pricing
View Details
2,3-Dimethylbutanoic Acid
419842-02 1 g

2,3-Dimethylbutanoic Acid

Sign In for Pricing
View Details