Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scg3 Peptide - C-terminal region

Scg3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1B1075, AI385542, Chgd, SgIII

UniProt

P47867

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scg3 Rabbit Polyclonal Antibody (orb584335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158262

Preservative

Lyophilized powder

AA Sequence

TGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenyl 2,6-di-O-acetyl-3,4-O-isopropylidene-b-D-thiogalactopyranoside
294369-01 10 g

Phenyl 2,6-di-O-acetyl-3,4-O-isopropylidene-b-D-thiogalactopyranoside

Sign In for Pricing
View Details
Phenyl 2,6-di-O-acetyl-3,4-O-isopropylidene-b-D-thiogalactopyranoside
294369-02 25 g

Phenyl 2,6-di-O-acetyl-3,4-O-isopropylidene-b-D-thiogalactopyranoside

Sign In for Pricing
View Details
Phenyl 2,6-di-O-acetyl-3,4-O-isopropylidene-b-D-thiogalactopyranoside
294369-03 50 g

Phenyl 2,6-di-O-acetyl-3,4-O-isopropylidene-b-D-thiogalactopyranoside

Sign In for Pricing
View Details
ZDHHC4 (NM_001134387) Human Tagged ORF Clone Lentiviral Particle
RC225511L4V 200 µL

ZDHHC4 (NM_001134387) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LCMT1 (Leucine Carboxyl Methyltransferase 1, Protein-leucine O-methyltransferase, [Phosphatase 2A Protein]-leucine-carboxy Methyltransferase 1, LCMT, CGI-68) (MaxLight 750) discontinued
129029-ML750 100 µL

LCMT1 (Leucine Carboxyl Methyltransferase 1, Protein-leucine O-methyltransferase, [Phosphatase 2A Protein]-leucine-carboxy Methyltransferase 1, LCMT, CGI-68) (MaxLight 750) discontinued

Sign In for Pricing
View Details
KRTAP20-2 CRISPR Activation Plasmid (m)
sc-436926-ACT 20 µg

KRTAP20-2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details