Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCG3 Peptide - C-terminal region

SCG3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ90833, SGIII

UniProt

Q8WXD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCG3 Rabbit Polyclonal Antibody (orb584336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037375

Preservative

Lyophilized powder

AA Sequence

LQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zaltoprofen
TRC-Z146000-1G 1 g

Zaltoprofen

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/3131R), CF405S conjugate, 0.1mg/mL
BNC043131-100 1x 100 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/3131R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS702638 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
DCTN3 Rabbit Polyclonal Antibody
TA369075 100 µL

DCTN3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), CF640R conjugate, 0.1mg/mL
BNC403605-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGI1 Recombinant Rabbit monoclonal Antibody
HA723258 100 µL

MAGI1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details