Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCG3 Peptide - C-terminal region

SCG3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ90833, SGIII

UniProt

Q8WXD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCG3 Rabbit Polyclonal Antibody (orb584336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037375

Preservative

Lyophilized powder

AA Sequence

LQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D4S234E (NSG1) (NM_001040101) Human Over-expression Lysate
LC421674 20 µg

D4S234E (NSG1) (NM_001040101) Human Over-expression Lysate

Sign In for Pricing
View Details
Cathepsin B (CTSB) (NM_147783) Human Recombinant Protein
TP310578M 100 µg

Cathepsin B (CTSB) (NM_147783) Human Recombinant Protein

Sign In for Pricing
View Details
(3S-cis)-4-(3-Amino-2-oxopropyl)-3-ethyldihydro-2(3H)-Furanone Hydrochloride Salt
TRC-A277450-10MG 10 mg

(3S-cis)-4-(3-Amino-2-oxopropyl)-3-ethyldihydro-2(3H)-Furanone Hydrochloride Salt

Sign In for Pricing
View Details
Aspergillus Mouse Monoclonal Antibody [Clone ID: WF-AF-1]
AM05894PU-N 250 µg

Aspergillus Mouse Monoclonal Antibody [Clone ID: WF-AF-1]

Sign In for Pricing
View Details
LSM2 Mouse Monoclonal Antibody [Clone ID: 1G7]
AM50011PU-S 50 µL

LSM2 Mouse Monoclonal Antibody [Clone ID: 1G7]

Sign In for Pricing
View Details
DEF8 (NM_207514) Human Over-expression Lysate
LY403723 100 µg

DEF8 (NM_207514) Human Over-expression Lysate

Sign In for Pricing
View Details