Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Schip1 Peptide - N-terminal region

Schip1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Nf2ip, SCHIP-1, Schip-1a, Schip-1b, Schip-1

UniProt

Q3TI53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Schip1 Rabbit Polyclonal Antibody (orb582222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001106892

Preservative

Lyophilized powder

AA Sequence

PFPVYQKKVIDEWAPEEDGEEEEEEDDRGYRDDGCPAREPGDVSARIGSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOCK8 Human Gene Knockout Kit (CRISPR)
KN422789 1 Kit

DOCK8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559215 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
UBE2I Mouse Monoclonal Antibody [Clone ID: 1B10]
AM06691SU-N 100 µL

UBE2I Mouse Monoclonal Antibody [Clone ID: 1B10]

Sign In for Pricing
View Details
17alpha-Dydrogesterone
TRC-D825995-10MG 10 mg

17alpha-Dydrogesterone

Sign In for Pricing
View Details
BTNL8 (NM_001159709) Human Over-expression Lysate
LY431331 100 µg

BTNL8 (NM_001159709) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS804469 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details