Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Schip1 Peptide - N-terminal region

Schip1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Nf2ip, SCHIP-1, Schip-1a, Schip-1b, Schip-1

UniProt

Q3TI53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Schip1 Rabbit Polyclonal Antibody (orb582222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001106892

Preservative

Lyophilized powder

AA Sequence

PFPVYQKKVIDEWAPEEDGEEEEEEDDRGYRDDGCPAREPGDVSARIGSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon: right
CB501329 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG1), CF488A conjugate, 0.1mg/mL
BNC881686-500 1x 500 µL

VEGF (Vascular Endothelial Growth Factor) (VG1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560900 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
CD45RB (PTPRC/1132), CF647 conjugate, 0.1mg/mL
BNC471132-500 1x 500 µL

CD45RB (PTPRC/1132), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB519658 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
p38 (CRK) (NM_016823) Human Over-expression Lysate
LY402580 100 µg

p38 (CRK) (NM_016823) Human Over-expression Lysate

Sign In for Pricing
View Details