Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scyl3 Peptide - middle region

Scyl3 Peptide - middle region

Product Specifications

Product Name Alternative

1200016D23Rik, 6030457O16, AW214499, Pace1

UniProt

Q9DBQ7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scyl3 Rabbit Polyclonal Antibody (orb326234) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083052

Preservative

Lyophilized powder

AA Sequence

NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc19a2-set siRNA/shRNA/RNAi Lentivector (Mouse)
43920094 4x 500 ng

Slc19a2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
GUSB Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV687605 1.0 µg DNA

GUSB Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Frmd3 (NM_172869) Mouse Untagged Clone
MC219580 10 µg

Frmd3 (NM_172869) Mouse Untagged Clone

Sign In for Pricing
View Details
Human Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit
MBS3801773-01 48 Well

Human Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit

Sign In for Pricing
View Details
Human Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit
MBS3801773-02 96 Well

Human Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit

Sign In for Pricing
View Details
Human Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit
MBS3801773-03 5x 96 Well

Human Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit

Sign In for Pricing
View Details