Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sdc3 Peptide - N-terminal region

Sdc3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC65603, MGC69616, Synd3, mKIAA0468, syn-3

UniProt

Q64519

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sdc3 Rabbit Polyclonal Antibody (orb579947) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035650

Preservative

Lyophilized powder

AA Sequence

GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Cathepsin G Antibody
YLD1226-01 50 µL

Rabbit anti-Cathepsin G Antibody

Sign In for Pricing
View Details
Rabbit anti-Cathepsin G Antibody
YLD1226-02 100 µL

Rabbit anti-Cathepsin G Antibody

Sign In for Pricing
View Details
NMUR1 Protein Vector (Human) (pPB-C-His)
PV028517 500 ng

NMUR1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Porcine CytoKeratin 19 ELISA Kit
MBS743110-01 48 Well

Porcine CytoKeratin 19 ELISA Kit

Sign In for Pricing
View Details
Porcine CytoKeratin 19 ELISA Kit
MBS743110-02 96 Well

Porcine CytoKeratin 19 ELISA Kit

Sign In for Pricing
View Details
Porcine CytoKeratin 19 ELISA Kit
MBS743110-03 5x 96 Well

Porcine CytoKeratin 19 ELISA Kit

Sign In for Pricing
View Details