Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sdc3 Peptide - N-terminal region

Sdc3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC65603, MGC69616, Synd3, mKIAA0468, syn-3

UniProt

Q64519

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sdc3 Rabbit Polyclonal Antibody (orb579947) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035650

Preservative

Lyophilized powder

AA Sequence

GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Seoul virus One-Step PCR kit
Oneq-VH395-100R 100 Reactions

Seoul virus One-Step PCR kit

Sign In for Pricing
View Details
OTOR Human, His
PT-A04044-01 5 µg

OTOR Human, His

Sign In for Pricing
View Details
OTOR Human, His
PT-A04044-02 20 µg

OTOR Human, His

Sign In for Pricing
View Details
OTOR Human, His
PT-A04044-03 1 mg

OTOR Human, His

Sign In for Pricing
View Details
Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, 1000 un, DNase/RNase free - ABDOS
P10235 1000 Units/Pack

Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, 1000 un, DNase/RNase free - ABDOS

Sign In for Pricing
View Details
Mouse Monoclonal Carboxypeptidase B1/CPB1 Antibody (4D5)
H00001360-M01 0.1 mg

Mouse Monoclonal Carboxypeptidase B1/CPB1 Antibody (4D5)

Sign In for Pricing
View Details