Sdhb Peptide - middle region
Sdhb Peptide - middle region
Product Specifications
Product Name Alternative
0710008N11Rik
UniProt
Q9CQA3
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Sdhb Rabbit Polyclonal Antibody (orb330525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_075863
Preservative
Lyophilized powder
AA Sequence
IKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDGLYE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-15123R-Cy5.5 100 µL
C21ORF13 Polyclonal Antibody, Cy5.5 Conjugated
Sign In for Pricing
View Details MBS7015131-01 0.02 mg
Recombinant Klebsiella pneumoniae Fumarate reductase subunit D (frdD)
Sign In for Pricing
View Details MBS7015131-02 0.1 mg
Recombinant Klebsiella pneumoniae Fumarate reductase subunit D (frdD)
Sign In for Pricing
View Details MBS7015131-03 5x 0.1 mg
Recombinant Klebsiella pneumoniae Fumarate reductase subunit D (frdD)
Sign In for Pricing
View Details