Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sdhb Peptide - middle region

Sdhb Peptide - middle region

Product Specifications

Product Name Alternative

0710008N11Rik

UniProt

Q9CQA3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sdhb Rabbit Polyclonal Antibody (orb330525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075863

Preservative

Lyophilized powder

AA Sequence

IKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDGLYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SWAP70 Protein Vector (Human) (pPB-N-His)
PV040942 500 ng

SWAP70 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
SLC22A8 discontinued
394486 200 µL

SLC22A8 discontinued

Sign In for Pricing
View Details
Anti-PSS-1 Antibody
MBS8307824-01 0.03 mL

Anti-PSS-1 Antibody

Sign In for Pricing
View Details
Anti-PSS-1 Antibody
MBS8307824-02 0.05 mL

Anti-PSS-1 Antibody

Sign In for Pricing
View Details
Anti-PSS-1 Antibody
MBS8307824-03 0.1 mL

Anti-PSS-1 Antibody

Sign In for Pricing
View Details
Anti-PSS-1 Antibody
MBS8307824-04 0.2 mL

Anti-PSS-1 Antibody

Sign In for Pricing
View Details