Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sec11c Peptide - C-terminal region

Sec11c Peptide - C-terminal region

Product Specifications

Product Name Alternative

1810029G24Rik, Sec11l3

UniProt

Q9D8V7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sec11c Rabbit Polyclonal Antibody (orb325556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079744

Preservative

Lyophilized powder

AA Sequence

VHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complexin-4 (h) -PR
sc-72968-PR 10 µM - 20 µL

Complexin-4 (h) -PR

Sign In for Pricing
View Details
Hamster Paladin (PALD) ELISA Kit
MBS9348753-01 48 Well

Hamster Paladin (PALD) ELISA Kit

Sign In for Pricing
View Details
Hamster Paladin (PALD) ELISA Kit
MBS9348753-02 96 Well

Hamster Paladin (PALD) ELISA Kit

Sign In for Pricing
View Details
Hamster Paladin (PALD) ELISA Kit
MBS9348753-03 5x 96 Well

Hamster Paladin (PALD) ELISA Kit

Sign In for Pricing
View Details
Hamster Paladin (PALD) ELISA Kit
MBS9348753-04 10x 96 Well

Hamster Paladin (PALD) ELISA Kit

Sign In for Pricing
View Details
MARCH3 sgRNA CRISPR Lentivector (Human) (Target 2)
K2780903 1.0 µg DNA

MARCH3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details