Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sec11c Peptide - C-terminal region

Sec11c Peptide - C-terminal region

Product Specifications

Product Name Alternative

1810029G24Rik, Sec11l3

UniProt

Q9D8V7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sec11c Rabbit Polyclonal Antibody (orb325556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079744

Preservative

Lyophilized powder

AA Sequence

VHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCEE Peptide - C-terminal region (AAP60330)
AAP60330-100UG 100 µg

MCEE Peptide - C-terminal region (AAP60330)

Sign In for Pricing
View Details
Lesopitron dihydrochloride
MBS387516-01 1 mg

Lesopitron dihydrochloride

Sign In for Pricing
View Details
Lesopitron dihydrochloride
MBS387516-02 5 mg

Lesopitron dihydrochloride

Sign In for Pricing
View Details
Lesopitron dihydrochloride
MBS387516-03 10 mg

Lesopitron dihydrochloride

Sign In for Pricing
View Details
Lesopitron dihydrochloride
MBS387516-04 50 mg

Lesopitron dihydrochloride

Sign In for Pricing
View Details
Lesopitron dihydrochloride
MBS387516-05 5x 50 mg

Lesopitron dihydrochloride

Sign In for Pricing
View Details