Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sec14l3 Peptide - C-terminal region

Sec14l3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Spf2

UniProt

Q9Z1J8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sec14l3 Rabbit Polyclonal Antibody (orb582859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_072130

Preservative

Lyophilized powder

AA Sequence

RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2 Mouse Monoclonal Antibody [Clone ID: OTI5F8]
CF813551 100 µg

MAP2 Mouse Monoclonal Antibody [Clone ID: OTI5F8]

Sign In for Pricing
View Details
KCNQ3 Human Gene Knockout Kit (CRISPR)
KN418739 1 Kit

KCNQ3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD565262 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
Recombinant Mouse Component C3a protein (TRX, His tag)
PDEM100242-01 20 µg

Recombinant Mouse Component C3a protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Mouse Component C3a protein (TRX, His tag)
PDEM100242-02 100 µg

Recombinant Mouse Component C3a protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Mouse Component C3a protein (TRX, His tag)
PDEM100242-03 500 µg

Recombinant Mouse Component C3a protein (TRX, His tag)

Sign In for Pricing
View Details