Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sec14l3 Peptide - C-terminal region

Sec14l3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Spf2

UniProt

Q9Z1J8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sec14l3 Rabbit Polyclonal Antibody (orb582859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_072130

Preservative

Lyophilized powder

AA Sequence

RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG5 (Autophagy Marker) (ATG5/2101), CF647 conjugate, 0.1mg/mL
BNC472101-100 1x 100 µL

ATG5 (Autophagy Marker) (ATG5/2101), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF543 conjugate, 0.1mg/mL
BNC432615-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ETS1 (NM_005238) Human Recombinant Protein
TP315203 20 µg

ETS1 (NM_005238) Human Recombinant Protein

Sign In for Pricing
View Details
Ethyl 3-Hydroxyphenylacetate
TRC-E919075-2G 2 g

Ethyl 3-Hydroxyphenylacetate

Sign In for Pricing
View Details
Human CD23 (FCER2) activation kit by CRISPRa
GA101546 1 Kit

Human CD23 (FCER2) activation kit by CRISPRa

Sign In for Pricing
View Details
Human Transaldolase 1 (TALDO1) activation kit by CRISPRa
GA104747 1 Kit

Human Transaldolase 1 (TALDO1) activation kit by CRISPRa

Sign In for Pricing
View Details