Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC23IP Peptide - N-terminal region

SEC23IP Peptide - N-terminal region

Product Specifications

Product Name Alternative

MSTP053, P125, P125A

UniProt

Q9Y6Y8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEC23IP Rabbit Polyclonal Antibody (orb581654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009121

Preservative

Lyophilized powder

AA Sequence

SIHTSAPQTFSYFSQVSSSSDPFGNIGQSPLTTAATSVGQSGFPKPLTAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Reactive Oxygen Species Modulator 1 ELISA Kit
MBS063362-01 48 Well

Bovine Reactive Oxygen Species Modulator 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Reactive Oxygen Species Modulator 1 ELISA Kit
MBS063362-02 96 Well

Bovine Reactive Oxygen Species Modulator 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Reactive Oxygen Species Modulator 1 ELISA Kit
MBS063362-03 5x 96 Well

Bovine Reactive Oxygen Species Modulator 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Reactive Oxygen Species Modulator 1 ELISA Kit
MBS063362-04 10x 96 Well

Bovine Reactive Oxygen Species Modulator 1 ELISA Kit

Sign In for Pricing
View Details
ROM1 Rabbit Polyclonal Antibody (Biotin)
orb445198 100 µL

ROM1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Zmym3-set siRNA/shRNA/RNAi Lentivector (Rat)
51277096 4x 500 ng

Zmym3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details