Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC23IP Peptide - N-terminal region

SEC23IP Peptide - N-terminal region

Product Specifications

Product Name Alternative

MSTP053, P125, P125A

UniProt

Q9Y6Y8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEC23IP Rabbit Polyclonal Antibody (orb581654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009121

Preservative

Lyophilized powder

AA Sequence

SIHTSAPQTFSYFSQVSSSSDPFGNIGQSPLTTAATSVGQSGFPKPLTAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monocyte Chemotactic Protein 5 ELISA Kit
MBS038978-01 48 Well

Human Monocyte Chemotactic Protein 5 ELISA Kit

Sign In for Pricing
View Details
Human Monocyte Chemotactic Protein 5 ELISA Kit
MBS038978-02 96 Well

Human Monocyte Chemotactic Protein 5 ELISA Kit

Sign In for Pricing
View Details
Human Monocyte Chemotactic Protein 5 ELISA Kit
MBS038978-03 5x 96 Well

Human Monocyte Chemotactic Protein 5 ELISA Kit

Sign In for Pricing
View Details
Human Monocyte Chemotactic Protein 5 ELISA Kit
MBS038978-04 10x 96 Well

Human Monocyte Chemotactic Protein 5 ELISA Kit

Sign In for Pricing
View Details
Recombinant Anti-CEACAM6 Antibody (PE), Rabbit Monoclonal
MBS8104090-01 25 Tests

Recombinant Anti-CEACAM6 Antibody (PE), Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant Anti-CEACAM6 Antibody (PE), Rabbit Monoclonal
MBS8104090-02 100 Tests

Recombinant Anti-CEACAM6 Antibody (PE), Rabbit Monoclonal

Sign In for Pricing
View Details