Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sec31a Peptide - N-terminal region

Sec31a Peptide - N-terminal region

Product Specifications

Product Name Alternative

VAP1, Sec31l1, MGC93320, Sec31a

UniProt

Q9Z2Q1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sec31a Rabbit Polyclonal Antibody (orb582639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_148981

Preservative

Lyophilized powder

AA Sequence

DKEVVIAQKDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceramide synthase 2 (CERS2) (NM_181746) Human Recombinant Protein
TP315300M 100 µg

Ceramide synthase 2 (CERS2) (NM_181746) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Adrenal gland
CS629238 5x 5 µm

Frozen Tissue Sections, Adrenal gland

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB548371 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Brilliant Thallium Gold Snapshot Flex
11021-10 10 Plates

Brilliant Thallium Gold Snapshot Flex

Sign In for Pricing
View Details
GRK6 Human Gene Knockout Kit (CRISPR)
KN402464 1 Kit

GRK6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD68 (LAMP4/824), CF640R conjugate, 0.1mg/mL
BNC400824-500 1x 500 µL

CD68 (LAMP4/824), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details