Sec31a Peptide - N-terminal region
Sec31a Peptide - N-terminal region
Product Specifications
Product Name Alternative
VAP1, Sec31l1, MGC93320, Sec31a
UniProt
Q9Z2Q1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Sec31a Rabbit Polyclonal Antibody (orb582639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_148981
Preservative
Lyophilized powder
AA Sequence
DKEVVIAQKDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![OLFM4 Recombinant Rabbit Monoclonal Antibody [PSH01-37]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81178/imageurl/ha721671.webp)
HA721671 100 µL
OLFM4 Recombinant Rabbit Monoclonal Antibody [PSH01-37]
Sign In for Pricing
View Details 
TRC-D448300-25MG 25 mg
2,2-Diphenyl 2-(1-Boc-3-pyrrolidinyl)acetonitrile
Sign In for Pricing
View Details 
BNC471540-500 1x 500 µL
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 