Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SECTM1 Peptide - middle region

SECTM1 Peptide - middle region

Product Specifications

Product Name Alternative

K12

UniProt

Q8WVN6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SECTM1 Rabbit Polyclonal Antibody (orb325214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002995

Preservative

Lyophilized powder

AA Sequence

ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPUL2 Recombinant Protein Antigen
NBP1-92001PEP 0.1 mL

HNRNPUL2 Recombinant Protein Antigen

Sign In for Pricing
View Details
Human CD71 Antibody : FITC
OASB01130-100T 100 Tests

Human CD71 Antibody : FITC

Sign In for Pricing
View Details
CASPR Rabbit Polyclonal Antibody (PE)
orb498357 100 µL

CASPR Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
PSAT1 (PSA) discontinued
513192 100 µg

PSAT1 (PSA) discontinued

Sign In for Pricing
View Details
Recombinant Dog Zinc-activated ligand-gated ion channel (ZACN), partial
MBS7092030 Inquire

Recombinant Dog Zinc-activated ligand-gated ion channel (ZACN), partial

Sign In for Pricing
View Details
Sodium butane-1-sulfonate
HY-W017224-01 100 mg

Sodium butane-1-sulfonate

Sign In for Pricing
View Details