Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SECTM1 Peptide - middle region

SECTM1 Peptide - middle region

Product Specifications

Product Name Alternative

K12

UniProt

Q8WVN6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SECTM1 Rabbit Polyclonal Antibody (orb325214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002995

Preservative

Lyophilized powder

AA Sequence

ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl-HIST1H1E (K63) Antibody
A24763-50UL 50 μL

Acetyl-HIST1H1E (K63) Antibody

Sign In for Pricing
View Details
COPB1 siRNA (Human)
CRH0926-01 15 nmol

COPB1 siRNA (Human)

Sign In for Pricing
View Details
COPB1 siRNA (Human)
CRH0926-02 30 nmol

COPB1 siRNA (Human)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)
MBS2136490-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)
MBS2136490-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)
MBS2136490-03 0.5 mL

Cy3 Linked Monoclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)

Sign In for Pricing
View Details