SEMA4D Peptide - N-terminal region
SEMA4D Peptide - N-terminal region
Product Specifications
Product Name Alternative
C9orf164, CD100, FLJ33485, FLJ34282, FLJ39737, FLJ46484, M-sema-G, MGC169138, MGC169141, SEMAJ, coll-4
UniProt
Q92854
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEMA4D Rabbit Polyclonal Antibody (orb585042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001135759
Preservative
Lyophilized powder
AA Sequence
SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH031430 100 µg
Recombinant Human TGFBR3/Betaglycan Protein (His Tag)
Sign In for Pricing
View Details 
![AKT1/2/3 Recombinant Rabbit Monoclonal Antibody [ST48-09]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea82628/imageurl/et1609-51.webp)
ET1609-51 100 µL
AKT1/2/3 Recombinant Rabbit Monoclonal Antibody [ST48-09]
Sign In for Pricing
View Details 
GAF-011-5 1 mL
Colloidal Gold Conjugated Goat Purified Antibody To Mouse IgG, 5nm
Sign In for Pricing
View Details