Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMA4D Peptide - N-terminal region

SEMA4D Peptide - N-terminal region

Product Specifications

Product Name Alternative

C9orf164, CD100, FLJ33485, FLJ34282, FLJ39737, FLJ46484, M-sema-G, MGC169138, MGC169141, SEMAJ, coll-4

UniProt

Q92854

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEMA4D Rabbit Polyclonal Antibody (orb585042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001135759

Preservative

Lyophilized powder

AA Sequence

SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD226/DNAM-1 Protein (His Tag)
PKSH033728-01 10 µg

Recombinant Human CD226/DNAM-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD226/DNAM-1 Protein (His Tag)
PKSH033728-02 50 µg

Recombinant Human CD226/DNAM-1 Protein (His Tag)

Sign In for Pricing
View Details
RUNX2 Mouse Monoclonal Antibody [Clone ID: OTI3E12]
CF813668 100 µg

RUNX2 Mouse Monoclonal Antibody [Clone ID: OTI3E12]

Sign In for Pricing
View Details
Cytokeratin 8 (H1 + TS1), CF740 conjugate, 0.1mg/mL
BNC740687-500 1x 500 µL

Cytokeratin 8 (H1 + TS1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Amino-2-[2-(4-heptylphenyl)ethyl]propane-1,3-diol
TRC-A626900-5MG 5 mg

2-Amino-2-[2-(4-heptylphenyl)ethyl]propane-1,3-diol

Sign In for Pricing
View Details
Baat Mouse Gene Knockout Kit (CRISPR)
KN501947 1 Kit

Baat Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details