Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMG2 Peptide - N-terminal region

SEMG2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SGII

UniProt

Q02383

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEMG2 Rabbit Polyclonal Antibody (orb578333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002999

Preservative

Lyophilized powder

AA Sequence

GQKGQHYFGQKDQQHTKSKGSFSIQHTYHVDINDHDWTRKSQQYDLNALH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A.J (H2AFJ) Human Gene Knockout Kit (CRISPR)
KN400117 1 Kit

Histone H2A.J (H2AFJ) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-
BA-1102-5 1 mg

Biotin Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-

Sign In for Pricing
View Details
OSR2 Human qPCR Primer Pair (NM_001142462)
HP232231 200 Reactions

OSR2 Human qPCR Primer Pair (NM_001142462)

Sign In for Pricing
View Details
Biotin Conjugated Human Osteopontin Recombinant Rabbit Monoclonal Antibody [PSH08-60] - Detector
HA723008B 100 µL

Biotin Conjugated Human Osteopontin Recombinant Rabbit Monoclonal Antibody [PSH08-60] - Detector

Sign In for Pricing
View Details
Human ZFYVE28 activation kit by CRISPRa
GA111720 1 Kit

Human ZFYVE28 activation kit by CRISPRa

Sign In for Pricing
View Details
Human PGBD4 activation kit by CRISPRa
GA116033 1 Kit

Human PGBD4 activation kit by CRISPRa

Sign In for Pricing
View Details