Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMG2 Peptide - N-terminal region

SEMG2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SGII

UniProt

Q02383

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEMG2 Rabbit Polyclonal Antibody (orb578333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002999

Preservative

Lyophilized powder

AA Sequence

GQKGQHYFGQKDQQHTKSKGSFSIQHTYHVDINDHDWTRKSQQYDLNALH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI8E9]
CF805400 100 µg

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI8E9]

Sign In for Pricing
View Details
Rat CD3 epsilon&CD3 delta Heterodimer Protein, Llama Fc Tag&Llama Fc Tag (MALS verified)
CDD-R5257-100ug 100 µg

Rat CD3 epsilon&CD3 delta Heterodimer Protein, Llama Fc Tag&Llama Fc Tag (MALS verified)

Sign In for Pricing
View Details
(S)-(+)-N-3-Benzylnirvanol
TRC-B285775-50MG 50 mg

(S)-(+)-N-3-Benzylnirvanol

Sign In for Pricing
View Details
UTP15 antibody
FNab09348 100 µg

UTP15 antibody

Sign In for Pricing
View Details
Awat2 Mouse Gene Knockout Kit (CRISPR)
KN501891 1 Kit

Awat2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FAM130A1 (CSRNP2) activation kit by CRISPRa
GA113070 1 Kit

Human FAM130A1 (CSRNP2) activation kit by CRISPRa

Sign In for Pricing
View Details