Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SENP2 Peptide - middle region

SENP2 Peptide - middle region

Product Specifications

Product Name Alternative

AXAM2, DKFZp762A2316, KIAA1331, SMT3IP2

UniProt

Q9HC62

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SENP2 Rabbit Polyclonal Antibody (orb583607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067640

Preservative

Lyophilized powder

AA Sequence

RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPM2 CRISPR Activation Plasmid (m2)
sc-435898-ACT-2 20 µg

NPM2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
SCFD1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
43143154 3x 1.0 µg DNA

SCFD1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
FAM133A siRNA (Human)
MBS8202240-01 15 nmol

FAM133A siRNA (Human)

Sign In for Pricing
View Details
FAM133A siRNA (Human)
MBS8202240-02 30 nmol

FAM133A siRNA (Human)

Sign In for Pricing
View Details
FAM133A siRNA (Human)
MBS8202240-03 5x 30 nmol

FAM133A siRNA (Human)

Sign In for Pricing
View Details
NDUFS1 Antibody
orb673982-01 50 µg

NDUFS1 Antibody

Sign In for Pricing
View Details