SENP2 Peptide - middle region
SENP2 Peptide - middle region
Product Specifications
Product Name Alternative
AXAM2, DKFZp762A2316, KIAA1331, SMT3IP2
UniProt
Q9HC62
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SENP2 Rabbit Polyclonal Antibody (orb583607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067640
Preservative
Lyophilized powder
AA Sequence
RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC230227L2 10 µg
MCT7 (SLC16A6) (NM_001174166) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
K3268203 1.0 µg DNA
Ulbp1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
MBS965353 Inquire
Recombinant Rabbit Sarcoplasmic reticulum histidine-rich calcium-binding protein (HRC), partial
Sign In for Pricing
View Details OKIA00051 96 Well
Alpha 1-Microglobulin ELISA Kit (Human) (OKIA00051)
Sign In for Pricing
View Details E0606Ra-01 48 Well
Rat advanced glycation end products, AGEs ELISA KIT
Sign In for Pricing
View Details