Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SELENON Peptide - C-terminal region

SELENON Peptide - C-terminal region

Product Specifications

Product Name Alternative

SelN, Sepn1, AI414492, 1110019I12Rik

UniProt

D3Z5N3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SELENON Rabbit Polyclonal Antibody (orb580156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_083376

Preservative

Lyophilized powder

AA Sequence

VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF6 Antibody - C-terminal region : FITC (ARP38653_P050-FITC)
ARP38653_P050-FITC 100 µL

TAF6 Antibody - C-terminal region : FITC (ARP38653_P050-FITC)

Sign In for Pricing
View Details
PROM1 Antibody
orb3159995-01 50 µL

PROM1 Antibody

Sign In for Pricing
View Details
PROM1 Antibody
orb3159995-02 100 µL

PROM1 Antibody

Sign In for Pricing
View Details
Human Epididymal Protein 4 (HE4) ELISA Kit
MBS733932-01 48 Well

Human Epididymal Protein 4 (HE4) ELISA Kit

Sign In for Pricing
View Details
Human Epididymal Protein 4 (HE4) ELISA Kit
MBS733932-02 96 Well

Human Epididymal Protein 4 (HE4) ELISA Kit

Sign In for Pricing
View Details
Human Epididymal Protein 4 (HE4) ELISA Kit
MBS733932-03 5x 96 Well

Human Epididymal Protein 4 (HE4) ELISA Kit

Sign In for Pricing
View Details