Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT-12 Peptide - middle region

SEPT-12 Peptide - middle region

Product Specifications

Product Name Alternative

1700028G04Rik, 4933413B09Rik, MGC144518, Septin12

UniProt

Q9D451

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEPT12 Rabbit Polyclonal Antibody (orb55691) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081945

Preservative

Lyophilized powder

AA Sequence

KGLKLKLTVTDTPGFGDQINNDKCWDPILSYINQQYEQYLQEELLITRQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromofuran
TRC-B684510-2.5G 2.5 g

3-Bromofuran

Sign In for Pricing
View Details
RGS4 (NM_001102445) Human Over-expression Lysate
LY420150 100 µg

RGS4 (NM_001102445) Human Over-expression Lysate

Sign In for Pricing
View Details
PSAP (NM_001042466) Human Over-expression Lysate
LC420920 20 µg

PSAP (NM_001042466) Human Over-expression Lysate

Sign In for Pricing
View Details
DEK Recombinant Rabbit Monoclonal Antibody [JB36-32]
ET7107-99 100 µL

DEK Recombinant Rabbit Monoclonal Antibody [JB36-32]

Sign In for Pricing
View Details
TRPC4 (NM_016179) Human Over-expression Lysate
LY402514 100 µg

TRPC4 (NM_016179) Human Over-expression Lysate

Sign In for Pricing
View Details
Bnip1 Mouse Gene Knockout Kit (CRISPR)
KN502212 1 Kit

Bnip1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details