Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT-9 Peptide - middle region

SEPT-9 Peptide - middle region

Product Specifications

Product Name Alternative

AF17q25, KIAA0991, MSF, MSF1, NAPB, PNUTL4, SINT1, SeptD1

UniProt

Q9UHD8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEPT9 Rabbit Polyclonal Antibody (orb325686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001106964

Preservative

Lyophilized powder

AA Sequence

VNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog/Canine Anti-Methylglyoxal Antibody AMA ELISA Kit
BG-CAN10091 1 Each

Dog/Canine Anti-Methylglyoxal Antibody AMA ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse N4bp2 shRNA (UAS) - Lentiviral mouse N4bp2 shRNA (UAS, iRFP) plasmid
GTR15305575 1 Vial

Lentiviral mouse N4bp2 shRNA (UAS) - Lentiviral mouse N4bp2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lamin B1 discontinued
511040 100 µg

Lamin B1 discontinued

Sign In for Pricing
View Details
Krt85 ORF Vector (Rat) (pORF)
ORF069226 1.0 µg DNA

Krt85 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Chicken Tubulin beta 3 Antibody
orb3011859-01 50 µL

Chicken Tubulin beta 3 Antibody

Sign In for Pricing
View Details
Chicken Tubulin beta 3 Antibody
orb3011859-02 100 µL

Chicken Tubulin beta 3 Antibody

Sign In for Pricing
View Details