Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINA10 Peptide - middle region

SERPINA10 Peptide - middle region

Product Specifications

Product Name Alternative

PZI, ZPI

UniProt

Q9UK55

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_057270

Preservative

Lyophilized powder

AA Sequence

SPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC6A12 (NM_001122847) Human Over-expression Lysate
LC426578 20 µg

SLC6A12 (NM_001122847) Human Over-expression Lysate

Sign In for Pricing
View Details
Centrin 3 (CETN3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]
TA805871BM 100 µL

Centrin 3 (CETN3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]

Sign In for Pricing
View Details
Human SDF4 activation kit by CRISPRa
GA109608 1 Kit

Human SDF4 activation kit by CRISPRa

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF405S conjugate, 0.1mg/mL
BNC041484-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CITED1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E11]
TA807048AM 100 µL

CITED1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E11]

Sign In for Pricing
View Details
Utp14a Mouse Gene Knockout Kit (CRISPR)
KN518822 1 Kit

Utp14a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details