Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINA4 Peptide - middle region

SERPINA4 Peptide - middle region

Product Specifications

Product Name Alternative

KAL, KLST, KST, PI4, kallistatin, PI-4

UniProt

P29622

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINA4 Rabbit Polyclonal Antibody (orb584270) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006206

Preservative

Lyophilized powder

AA Sequence

KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep300/CREBBP-IN-8
MBS5815963 Inquire

Ep300/CREBBP-IN-8

Sign In for Pricing
View Details
Pak1ip1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7333907 1.0 µg DNA

Pak1ip1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant HER-2 Antibody / ErbB2
V5368-20UG 20 µg

Recombinant HER-2 Antibody / ErbB2

Sign In for Pricing
View Details
Rabbit Polyclonal SOX9 Antibody [Biotin]
NBP2-24659B 0.1 mL

Rabbit Polyclonal SOX9 Antibody [Biotin]

Sign In for Pricing
View Details
PFKFB4 Human shRNA Plasmid Kit (Locus ID 5210)
TL310483 1 Kit

PFKFB4 Human shRNA Plasmid Kit (Locus ID 5210)

Sign In for Pricing
View Details
H-Asp (Obzl) -OtBu.HCl 10000mg
A23359-10000 10000 mg

H-Asp (Obzl) -OtBu.HCl 10000mg

Sign In for Pricing
View Details