Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINA4 Peptide - middle region

SERPINA4 Peptide - middle region

Product Specifications

Product Name Alternative

KAL, KLST, KST, PI4, kallistatin, PI-4

UniProt

P29622

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINA4 Rabbit Polyclonal Antibody (orb584270) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006206

Preservative

Lyophilized powder

AA Sequence

KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Exportin 5 Recombinant Antibody, FITC Conjugated
bsm-61945R-FITC-TR 20 µL

Exportin 5 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Fish High Mobility Group Box1 Protein ELISA Kit
MBS033566-01 48 Well

Fish High Mobility Group Box1 Protein ELISA Kit

Sign In for Pricing
View Details
Fish High Mobility Group Box1 Protein ELISA Kit
MBS033566-02 96 Well

Fish High Mobility Group Box1 Protein ELISA Kit

Sign In for Pricing
View Details
Fish High Mobility Group Box1 Protein ELISA Kit
MBS033566-03 5x 96 Well

Fish High Mobility Group Box1 Protein ELISA Kit

Sign In for Pricing
View Details
Fish High Mobility Group Box1 Protein ELISA Kit
MBS033566-04 10x 96 Well

Fish High Mobility Group Box1 Protein ELISA Kit

Sign In for Pricing
View Details
CLCA2 3'UTR Lenti-reporter-Luc Vector
16241081 1.0 µg

CLCA2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details