SERPINB13 Peptide - middle region
SERPINB13 Peptide - middle region
Product Specifications
Product Name Alternative
HSHUR7SEQ, HUR7, MGC126870, PI13, headpin
UniProt
Q9UIV8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SERPINB13 Rabbit Polyclonal Antibody (orb326283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036529
Preservative
Lyophilized powder
AA Sequence
MVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942168-100 1x 100 µL
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882741-100 1x 100 µL
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A6]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90854e/imageurl/cf809270.webp)
CF809270 100 µg
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A6]
Sign In for Pricing
View Details 
