Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB13 Peptide - middle region

SERPINB13 Peptide - middle region

Product Specifications

Product Name Alternative

HSHUR7SEQ, HUR7, MGC126870, PI13, headpin

UniProt

Q9UIV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB13 Rabbit Polyclonal Antibody (orb326283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036529

Preservative

Lyophilized powder

AA Sequence

MVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp511 Mouse Gene Knockout Kit (CRISPR)
KN519860 1 Kit

Zfp511 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Boc-His(Trt)-Aib-OH
TRC-B656215-2.5G 2.5 g

Boc-His(Trt)-Aib-OH

Sign In for Pricing
View Details
BMAL1 (ARNTL) (NM_001178) Human Recombinant Protein
TP307870M 100 µg

BMAL1 (ARNTL) (NM_001178) Human Recombinant Protein

Sign In for Pricing
View Details
POTEA (NM_001002920) Human Over-expression Lysate
LC424116 20 µg

POTEA (NM_001002920) Human Over-expression Lysate

Sign In for Pricing
View Details
HSP60 (HSPD1/780), 0.2mg/mL
BNUB0780-100 1x 100 µL

HSP60 (HSPD1/780), 0.2mg/mL

Sign In for Pricing
View Details