Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB2 Peptide - middle region

SERPINB2 Peptide - middle region

Product Specifications

Product Name Alternative

HsT1201, PAI, PAI-2, PAI2, PLANH2

UniProt

P05120

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002566

Preservative

Lyophilized powder

AA Sequence

DVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP210L Human Gene Knockout Kit (CRISPR)
KN415583 1 Kit

NUP210L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS648692 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Recombinant ENO1 / ENO2 / ENO3 Antibody
RC-5034-01 50 μL

Recombinant ENO1 / ENO2 / ENO3 Antibody

Sign In for Pricing
View Details
Recombinant ENO1 / ENO2 / ENO3 Antibody
RC-5034-02 100 µL

Recombinant ENO1 / ENO2 / ENO3 Antibody

Sign In for Pricing
View Details
Recombinant ENO1 / ENO2 / ENO3 Antibody
RC-5034-03 1 mL

Recombinant ENO1 / ENO2 / ENO3 Antibody

Sign In for Pricing
View Details
E-Click EdU Cell Proliferation Imaging Assay Kit (Red, Elab Fluor® 594)
E-CK-A377-01 50 Assays

E-Click EdU Cell Proliferation Imaging Assay Kit (Red, Elab Fluor® 594)

Sign In for Pricing
View Details