Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB7 Peptide - N-terminal region

SERPINB7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686D06190, MEGSIN, MGC120014, MGC120015

UniProt

O75635

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003775

Preservative

Lyophilized powder

AA Sequence

LSQIDKLLHVNTASGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 (B-Lymphocyte Marker) (CD19/3117), CF568 conjugate, 0.1mg/mL
BNC683117-100 1x 100 µL

CD19 (B-Lymphocyte Marker) (CD19/3117), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRMT4 (CARM1) Human Gene Knockout Kit (CRISPR)
KN417483 1 Kit

PRMT4 (CARM1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF488A conjugate, 0.1mg/mL
BNC882560-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant gamma Adaptin Antibody
RC-16324-01 50 μL

Recombinant gamma Adaptin Antibody

Sign In for Pricing
View Details
Recombinant gamma Adaptin Antibody
RC-16324-02 100 µL

Recombinant gamma Adaptin Antibody

Sign In for Pricing
View Details
Recombinant gamma Adaptin Antibody
RC-16324-03 1 mL

Recombinant gamma Adaptin Antibody

Sign In for Pricing
View Details