Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB7 Peptide - N-terminal region

SERPINB7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686D06190, MEGSIN, MGC120014, MGC120015

UniProt

O75635

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003775

Preservative

Lyophilized powder

AA Sequence

LSQIDKLLHVNTASGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

U2AF65 (U2AF2) Human Knockdown Lysate
LY300460 100 µg

U2AF65 (U2AF2) Human Knockdown Lysate

Sign In for Pricing
View Details
Streptavidin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS
MT0STF4-SA5/200 10x 96 Well Plates

Streptavidin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS

Sign In for Pricing
View Details
SLC24A4 Rabbit Polyclonal Antibody
TA381591 100 µL

SLC24A4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Vanillylnonanamide
TRC-V097635-5G 5 g

N-Vanillylnonanamide

Sign In for Pricing
View Details
ReadiUse™ microscope mounting solution
20009-AAT 50 mL

ReadiUse™ microscope mounting solution

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), 1mg/mL
BNUM1474-50 1x 50 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), 1mg/mL

Sign In for Pricing
View Details